Lineage for d2cchd1 (2cch D:181-308)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326510Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2326511Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2326512Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2326525Protein Cyclin A [47956] (2 species)
  7. 2326561Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
    Uniprot P20248 175-432
  8. 2326564Domain d2cchd1: 2cch D:181-308 [130240]
    Other proteins in same PDB: d2ccha2, d2ccha3, d2cchc2, d2cchc3
    automatically matched to d1vin_1
    complexed with atp, gol, so4

Details for d2cchd1

PDB Entry: 2cch (more details), 1.7 Å

PDB Description: the crystal structure of cdk2 cyclin a in complex with a substrate peptide derived from cdc modified with a gamma-linked atp analogue
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2cchd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cchd1 a.74.1.1 (D:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

SCOPe Domain Coordinates for d2cchd1:

Click to download the PDB-style file with coordinates for d2cchd1.
(The format of our PDB-style files is described here.)

Timeline for d2cchd1: