Lineage for d2cchb2 (2cch B:309-432)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718152Domain d2cchb2: 2cch B:309-432 [130238]
    Other proteins in same PDB: d2ccha2, d2ccha3, d2cchc2, d2cchc3
    automatically matched to d1vin_2
    complexed with atp, gol, so4

Details for d2cchb2

PDB Entry: 2cch (more details), 1.7 Å

PDB Description: the crystal structure of cdk2 cyclin a in complex with a substrate peptide derived from cdc modified with a gamma-linked atp analogue
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2cchb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cchb2 a.74.1.1 (B:309-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOPe Domain Coordinates for d2cchb2:

Click to download the PDB-style file with coordinates for d2cchb2.
(The format of our PDB-style files is described here.)

Timeline for d2cchb2: