SCOPe 2.03: Domain d2ccdb1: 2ccd B:26-435

Lineage for d2ccdb1 (2ccd B:26-435)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
   duplication: tandem repeat of two CCP-like domains

6. Protein Catalase-peroxidase KatG [74754] (4 species)
   only the N-terminal CCP-like domain binds heme

7. Species Mycobacterium tuberculosis [TaxId:1773] [109941] (3 PDB entries)
   Uniprot Q08129

8. Domain d2ccdb1: 2ccd B:26-435 [130230]
   automatically matched to d1sj2a1
   complexed with hem; mutant

Details for d2ccdb1

PDB Entry: 2ccd, 2.1 Å

PDB Description: crystal structure of the catalase-peroxidase (katg) and s315t mutant from mycobacterium tuberculosis

PDB Compounds: (B:) peroxidase/catalase t

SCOPe Domain Sequences for d2ccdb1:

Sequence; same for both SEQRES and ATOM records:

>d2ccdb1 a.93.1.3 (B:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]}
mkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevmt
tsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldkar
rllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatwl
gderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaal
ivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaittgievvwtntp
tkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlslr
vdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvpkqt

Timeline for d2ccdb1:

• d2ccdb1 first appeared in SCOP 1.73
  
• d2ccdb1 appears in SCOPe 2.02
  
• d2ccdb1 appears in SCOPe 2.04
  
• d2ccdb1 appears in the current release, SCOPe 2.08