SCOPe 2.08: Domain d2ccda1: 2ccd A:26-432

Lineage for d2ccda1 (2ccd A:26-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (14 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [254876] (5 PDB entries)

8. Domain d2ccda1: 2ccd A:26-432 [130228]
   automated match to d4c50a1
   complexed with hem; mutant

Details for d2ccda1

PDB Entry: 2ccd, 2.1 Å

PDB Description: crystal structure of the catalase-peroxidase (katg) and s315t mutant from mycobacterium tuberculosis

PDB Compounds: (A:) peroxidase/catalase t

SCOPe Domain Sequences for d2ccda1:

Sequence; same for both SEQRES and ATOM records:

>d2ccda1 a.93.1.0 (A:26-432) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevmt
tsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldkar
rllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatwl
gderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaal
ivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaittgievvwtntp
tkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlslr
vdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvp

Timeline for d2ccda1:

• d2ccda1 first appeared in SCOP 1.73
  
• d2ccda1 appears in SCOPe 2.07