Lineage for d2ccab2 (2cca B:433-740)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333804Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2333805Protein automated matches [191104] (14 species)
    not a true protein
  7. 2333897Species Mycobacterium tuberculosis [TaxId:1773] [254876] (5 PDB entries)
  8. 2333905Domain d2ccab2: 2cca B:433-740 [130225]
    automated match to d4c50a2
    complexed with hem; mutant

Details for d2ccab2

PDB Entry: 2cca (more details), 2 Å

PDB Description: Crystal structure of the catalase-peroxidase (KatG) and S315T mutant from Mycobacterium tuberculosis
PDB Compounds: (B:) peroxidase/catalase t

SCOPe Domain Sequences for d2ccab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccab2 a.93.1.0 (B:433-740) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgga
nggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaai
ekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlld
kanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepsp
addgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvm
nldrfdvr

SCOPe Domain Coordinates for d2ccab2:

Click to download the PDB-style file with coordinates for d2ccab2.
(The format of our PDB-style files is described here.)

Timeline for d2ccab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ccab1