Lineage for d2ccaa2 (2cca A:436-720)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644948Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 644949Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 645271Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 645272Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 645334Species Mycobacterium tuberculosis [TaxId:1773] [109941] (3 PDB entries)
  8. 645336Domain d2ccaa2: 2cca A:436-720 [130223]
    automatically matched to d1sj2a2
    complexed with hem; mutant

Details for d2ccaa2

PDB Entry: 2cca (more details), 2 Å

PDB Description: Crystal structure of the catalase-peroxidase (KatG) and S315T mutant from Mycobacterium tuberculosis
PDB Compounds: (A:) peroxidase/catalase t

SCOP Domain Sequences for d2ccaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]}
llwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrggangg
rirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaaieka
akaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlldkan
lltlsapemtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepspadd
gtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkf

SCOP Domain Coordinates for d2ccaa2:

Click to download the PDB-style file with coordinates for d2ccaa2.
(The format of our PDB-style files is described here.)

Timeline for d2ccaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ccaa1