Lineage for d2cc7a_ (2cc7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2613923Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 2613924Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
    automatically mapped to Pfam PF07311
  6. 2613934Protein automated matches [190247] (4 species)
    not a true protein
  7. 2613939Species Halobacterium salinarum [TaxId:478009] [187023] (12 PDB entries)
  8. 2613949Domain d2cc7a_: 2cc7 A: [130219]
    automated match to d1moga_
    complexed with cl, lum, mg, na, so4

Details for d2cc7a_

PDB Entry: 2cc7 (more details), 1.8 Å

PDB Description: complexes of dodecin with flavin and flavin-like ligands
PDB Compounds: (A:) vng1446h

SCOPe Domain Sequences for d2cc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cc7a_ d.230.2.1 (A:) automated matches {Halobacterium salinarum [TaxId: 478009]}
vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
feld

SCOPe Domain Coordinates for d2cc7a_:

Click to download the PDB-style file with coordinates for d2cc7a_.
(The format of our PDB-style files is described here.)

Timeline for d2cc7a_: