SCOPe 2.08: Domain d2cc2c2: 2cc2 C:8-192

Lineage for d2cc2c2 (2cc2 C:8-192)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families)

5. Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries)

8. Domain d2cc2c2: 2cc2 C:8-192 [130217]
   Other proteins in same PDB: d2cc2a1, d2cc2b1, d2cc2c1
   automated match to d1rqpa2
   complexed with 5ad, cl

Details for d2cc2c2

PDB Entry: 2cc2, 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine

PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2cc2c2:

Sequence, based on SEQRES records:

>d2cc2c2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

Sequence, based on observed residues (ATOM records):

>d2cc2c2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakqwagsgagferaegsyiyiapnngllttvle
ehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledheivrfnr

Timeline for d2cc2c2:

• d2cc2c2 first appeared in SCOP 1.73
  
• d2cc2c2 appears in SCOPe 2.07