Lineage for d2cc2c2 (2cc2 C:8-192)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151631Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 2151632Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 2151633Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 protein domains)
  6. 2151634Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 2151635Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries)
  8. 2151647Domain d2cc2c2: 2cc2 C:8-192 [130217]
    Other proteins in same PDB: d2cc2a1, d2cc2b1, d2cc2c1
    automated match to d1rqpa2
    complexed with 5ad, cl

Details for d2cc2c2

PDB Entry: 2cc2 (more details), 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine
PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2cc2c2:

Sequence, based on SEQRES records: (download)

>d2cc2c2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

Sequence, based on observed residues (ATOM records): (download)

>d2cc2c2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakqwagsgagferaegsyiyiapnngllttvle
ehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledheivrfnr

SCOPe Domain Coordinates for d2cc2c2:

Click to download the PDB-style file with coordinates for d2cc2c2.
(The format of our PDB-style files is described here.)

Timeline for d2cc2c2: