SCOPe 2.07: Domain d2cc2b1: 2cc2 B:193-298

Lineage for d2cc2b1 (2cc2 B:193-298)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)

8. Domain d2cc2b1: 2cc2 B:193-298 [130214]
   Other proteins in same PDB: d2cc2a2, d2cc2b2, d2cc2c2
   automated match to d1rqpa1
   complexed with 5ad, cl

Details for d2cc2b1

PDB Entry: 2cc2, 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine

PDB Compounds: (B:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2cc2b1:

Sequence; same for both SEQRES and ATOM records:

>d2cc2b1 b.141.1.1 (B:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d2cc2b1:

• d2cc2b1 first appeared in SCOP 1.73
  
• d2cc2b1 appears in SCOPe 2.06
  
• d2cc2b1 appears in the current release, SCOPe 2.08