![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
![]() | Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) ![]() |
![]() | Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein) |
![]() | Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species) |
![]() | Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries) |
![]() | Domain d2cc2b1: 2cc2 B:193-298 [130214] Other proteins in same PDB: d2cc2a2, d2cc2b2, d2cc2c2 automated match to d1rqpa1 complexed with 5ad, cl |
PDB Entry: 2cc2 (more details), 2 Å
SCOPe Domain Sequences for d2cc2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cc2b1 b.141.1.1 (B:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
Timeline for d2cc2b1:
![]() Domains from other chains: (mouse over for more information) d2cc2a1, d2cc2a2, d2cc2c1, d2cc2c2 |