Lineage for d2cc2b1 (2cc2 B:193-298)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412332Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2412333Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2412334Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)
  6. 2412335Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)
  7. 2412336Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)
  8. 2412347Domain d2cc2b1: 2cc2 B:193-298 [130214]
    Other proteins in same PDB: d2cc2a2, d2cc2b2, d2cc2c2
    automated match to d1rqpa1
    complexed with 5ad, cl

Details for d2cc2b1

PDB Entry: 2cc2 (more details), 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine
PDB Compounds: (B:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2cc2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cc2b1 b.141.1.1 (B:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOPe Domain Coordinates for d2cc2b1:

Click to download the PDB-style file with coordinates for d2cc2b1.
(The format of our PDB-style files is described here.)

Timeline for d2cc2b1: