Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein beta-Lactamase, class A [56606] (16 species) |
Species Mycobacterium fortuitum [TaxId:1766] [56615] (2 PDB entries) |
Domain d2cc1a1: 2cc1 A:27-293 [130211] automatically matched to d1mfoa_ |
PDB Entry: 2cc1 (more details), 2.13 Å
SCOPe Domain Sequences for d2cc1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cc1a1 e.3.1.1 (A:27-293) beta-Lactamase, class A {Mycobacterium fortuitum [TaxId: 1766]} apiddqlaelerrdnvliglyaanlqsgrrithrpdemfamcstfkgyvaarvlqmaehg eisldnrvfvdadalvpnspvtearagaemtlaelcqaalqrsdntaanlllktiggpaa vtafarsvgdertrldrwevelnsaipgdprdtstpaalavgyrailagdalsppqrgll edwmranqtssmraglpegwttadktgsgdygstndagiafgpdgqrlllvmmtrsqahd pkaenlrpligeltalvlpsll
Timeline for d2cc1a1: