Lineage for d2cc1a1 (2cc1 A:27-293)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013003Protein beta-Lactamase, class A [56606] (16 species)
  7. 3013240Species Mycobacterium fortuitum [TaxId:1766] [56615] (2 PDB entries)
  8. 3013242Domain d2cc1a1: 2cc1 A:27-293 [130211]
    automatically matched to d1mfoa_

Details for d2cc1a1

PDB Entry: 2cc1 (more details), 2.13 Å

PDB Description: crystal structure of the class a beta-lactamase from mycobacterium fortuitum
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2cc1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cc1a1 e.3.1.1 (A:27-293) beta-Lactamase, class A {Mycobacterium fortuitum [TaxId: 1766]}
apiddqlaelerrdnvliglyaanlqsgrrithrpdemfamcstfkgyvaarvlqmaehg
eisldnrvfvdadalvpnspvtearagaemtlaelcqaalqrsdntaanlllktiggpaa
vtafarsvgdertrldrwevelnsaipgdprdtstpaalavgyrailagdalsppqrgll
edwmranqtssmraglpegwttadktgsgdygstndagiafgpdgqrlllvmmtrsqahd
pkaenlrpligeltalvlpsll

SCOPe Domain Coordinates for d2cc1a1:

Click to download the PDB-style file with coordinates for d2cc1a1.
(The format of our PDB-style files is described here.)

Timeline for d2cc1a1: