Lineage for d2cc0b_ (2cc0 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458768Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2458862Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2458934Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 2458955Protein automated matches [190086] (3 species)
    not a true protein
  7. 2458965Species Streptomyces lividans [TaxId:1916] [187533] (1 PDB entry)
  8. 2458966Domain d2cc0b_: 2cc0 B: [130210]
    Other proteins in same PDB: d2cc0a1
    automated match to d2cc0a1
    complexed with act, zn

Details for d2cc0b_

PDB Entry: 2cc0 (more details), 1.6 Å

PDB Description: family 4 carbohydrate esterase from streptomyces lividans in complex with acetate
PDB Compounds: (B:) acetyl-xylan esterase

SCOPe Domain Sequences for d2cc0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cc0b_ c.6.2.3 (B:) automated matches {Streptomyces lividans [TaxId: 1916]}
acngyvgltfddgpsgstqsllnalrqnglratmfnqgqyaaqnpslvraqvdagmwvan
hsythphmtqlgqaqmdseisrtqqaiagagggtpklfrppygetnatlrsveakyglte
viwdvdsqdwnnastdaivqavsrlgngqvilmhdwpantlaaipriaqtlagkglcsgm
ispqtgravapd

SCOPe Domain Coordinates for d2cc0b_:

Click to download the PDB-style file with coordinates for d2cc0b_.
(The format of our PDB-style files is described here.)

Timeline for d2cc0b_: