Lineage for d2cc0b1 (2cc0 B:2-192)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689577Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 689615Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (6 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 689616Protein Acetyl-xylan esterase [141961] (1 species)
  7. 689617Species Streptomyces lividans [TaxId:1916] [141962] (1 PDB entry)
  8. 689619Domain d2cc0b1: 2cc0 B:2-192 [130210]
    automatically matched to 2CC0 A:1-192
    complexed with act, zn

Details for d2cc0b1

PDB Entry: 2cc0 (more details), 1.6 Å

PDB Description: family 4 carbohydrate esterase from streptomyces lividans in complex with acetate
PDB Compounds: (B:) acetyl-xylan esterase

SCOP Domain Sequences for d2cc0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cc0b1 c.6.2.3 (B:2-192) Acetyl-xylan esterase {Streptomyces lividans [TaxId: 1916]}
acngyvgltfddgpsgstqsllnalrqnglratmfnqgqyaaqnpslvraqvdagmwvan
hsythphmtqlgqaqmdseisrtqqaiagagggtpklfrppygetnatlrsveakyglte
viwdvdsqdwnnastdaivqavsrlgngqvilmhdwpantlaaipriaqtlagkglcsgm
ispqtgravap

SCOP Domain Coordinates for d2cc0b1:

Click to download the PDB-style file with coordinates for d2cc0b1.
(The format of our PDB-style files is described here.)

Timeline for d2cc0b1: