![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
![]() | Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families) ![]() in the different families beta-barrels are similarly distorted but may vary in the number of strands |
![]() | Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (6 proteins) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456 |
![]() | Protein Acetyl-xylan esterase [141961] (1 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [141962] (1 PDB entry) |
![]() | Domain d2cc0b1: 2cc0 B:2-192 [130210] automatically matched to 2CC0 A:1-192 complexed with act, zn |
PDB Entry: 2cc0 (more details), 1.6 Å
SCOP Domain Sequences for d2cc0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cc0b1 c.6.2.3 (B:2-192) Acetyl-xylan esterase {Streptomyces lividans [TaxId: 1916]} acngyvgltfddgpsgstqsllnalrqnglratmfnqgqyaaqnpslvraqvdagmwvan hsythphmtqlgqaqmdseisrtqqaiagagggtpklfrppygetnatlrsveakyglte viwdvdsqdwnnastdaivqavsrlgngqvilmhdwpantlaaipriaqtlagkglcsgm ispqtgravap
Timeline for d2cc0b1: