SCOPe 2.05: Domain d2cbye_: 2cby E:

Lineage for d2cbye_ (2cby E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187022] (7 PDB entries)

8. Domain d2cbye_: 2cby E: [130206]
   Other proteins in same PDB: d2cbya1
   automated match to d1tyfa_

Details for d2cbye_

PDB Entry: 2cby, 2.6 Å

PDB Description: crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis

PDB Compounds: (E:) ATP-dependent clp protease proteolytic subunit 1

SCOPe Domain Sequences for d2cbye_:

Sequence, based on SEQRES records:

>d2cbye_ c.14.1.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra

Sequence, based on observed residues (ATOM records):

>d2cbye_ c.14.1.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra

Timeline for d2cbye_:

• d2cbye_ first appeared in SCOP 1.73, called d2cbye1
  
• d2cbye_ appears in SCOPe 2.04
  
• d2cbye_ appears in SCOPe 2.06
  
• d2cbye_ appears in the current release, SCOPe 2.08