SCOPe 2.03: Domain d2cbyc_: 2cby C:

Lineage for d2cbyc_ (2cby C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (42 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187022] (6 PDB entries)

8. Domain d2cbyc_: 2cby C: [130204]
   Other proteins in same PDB: d2cbya1
   automated match to d1tyfa_

Details for d2cbyc_

PDB Entry: 2cby, 2.6 Å

PDB Description: crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis

PDB Compounds: (C:) ATP-dependent clp protease proteolytic subunit 1

SCOPe Domain Sequences for d2cbyc_:

Sequence, based on SEQRES records:

>d2cbyc_ c.14.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra

Sequence, based on observed residues (ATOM records):

>d2cbyc_ c.14.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra

Timeline for d2cbyc_:

• d2cbyc_ first appeared in SCOP 1.73, called d2cbyc1
  
• d2cbyc_ appears in SCOPe 2.02
  
• d2cbyc_ appears in SCOPe 2.04
  
• d2cbyc_ appears in the current release, SCOPe 2.08