SCOPe 2.02: Domain d2cbxc2: 2cbx C:8-192

Lineage for d2cbxc2 (2cbx C:8-192)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family)

5. Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [102525] (14 PDB entries)

8. Domain d2cbxc2: 2cbx C:8-192 [130201]
   Other proteins in same PDB: d2cbxa1, d2cbxb1, d2cbxc1
   automatically matched to d1rqpa2
   complexed with cc5, gol

Details for d2cbxc2

PDB Entry: 2cbx, 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with beta-d-erythrofuranosyl- adenosine

PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2cbxc2:

Sequence; same for both SEQRES and ATOM records:

>d2cbxc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

Timeline for d2cbxc2:

• d2cbxc2 first appeared in SCOP 1.73
  
• d2cbxc2 appears in SCOPe 2.01
  
• d2cbxc2 appears in SCOPe 2.03
  
• d2cbxc2 appears in the current release, SCOPe 2.08