Lineage for d2cbxc2 (2cbx C:8-192)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713497Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 713498Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) (S)
  5. 713499Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)
  6. 713500Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 713501Species Streptomyces cattleya [TaxId:29303] [102525] (9 PDB entries)
  8. 713507Domain d2cbxc2: 2cbx C:8-192 [130201]
    Other proteins in same PDB: d2cbxa1, d2cbxb1, d2cbxc1
    automatically matched to d1rqpa2
    complexed with cc5, gol

Details for d2cbxc2

PDB Entry: 2cbx (more details), 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with beta-d-erythrofuranosyl- adenosine
PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOP Domain Sequences for d2cbxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbxc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOP Domain Coordinates for d2cbxc2:

Click to download the PDB-style file with coordinates for d2cbxc2.
(The format of our PDB-style files is described here.)

Timeline for d2cbxc2: