Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) |
Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins) |
Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species) |
Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries) |
Domain d2cbxc2: 2cbx C:8-192 [130201] Other proteins in same PDB: d2cbxa1, d2cbxb1, d2cbxc1 automated match to d1rqpa2 complexed with cc5, gol |
PDB Entry: 2cbx (more details), 2 Å
SCOPe Domain Sequences for d2cbxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbxc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei vrfnr
Timeline for d2cbxc2:
View in 3D Domains from other chains: (mouse over for more information) d2cbxa1, d2cbxa2, d2cbxb1, d2cbxb2 |