Lineage for d2cbxa2 (2cbx A:8-192)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1012653Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 1012654Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) (S)
  5. 1012655Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)
  6. 1012656Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 1012657Species Streptomyces cattleya [TaxId:29303] [102525] (14 PDB entries)
  8. 1012670Domain d2cbxa2: 2cbx A:8-192 [130197]
    Other proteins in same PDB: d2cbxa1, d2cbxb1, d2cbxc1
    automatically matched to d1rqpa2
    complexed with cc5, gol

Details for d2cbxa2

PDB Entry: 2cbx (more details), 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with beta-d-erythrofuranosyl- adenosine
PDB Compounds: (A:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2cbxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbxa2 c.132.1.1 (A:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOPe Domain Coordinates for d2cbxa2:

Click to download the PDB-style file with coordinates for d2cbxa2.
(The format of our PDB-style files is described here.)

Timeline for d2cbxa2: