Lineage for d2cbvb1 (2cbv B:3-444)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816262Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (5 proteins)
  6. 816272Protein Beta-glucosidase A [51528] (7 species)
  7. 816312Species Thermotoga maritima [TaxId:2336] [89475] (23 PDB entries)
    Uniprot Q08638
  8. 816324Domain d2cbvb1: 2cbv B:3-444 [130195]
    automatically matched to d1od0b_
    complexed with act, cgb

Details for d2cbvb1

PDB Entry: 2cbv (more details), 1.95 Å

PDB Description: beta-glucosidase from thermotoga maritima in complex with calystegine b2
PDB Compounds: (B:) beta-glucosidase a

SCOP Domain Sequences for d2cbvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbvb1 c.1.8.4 (B:3-444) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngl

SCOP Domain Coordinates for d2cbvb1:

Click to download the PDB-style file with coordinates for d2cbvb1.
(The format of our PDB-style files is described here.)

Timeline for d2cbvb1: