Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (5 proteins) |
Protein Beta-glucosidase A [51528] (7 species) |
Species Thermotoga maritima [TaxId:2336] [89475] (22 PDB entries) |
Domain d2cbvb1: 2cbv B:3-444 [130195] automatically matched to d1od0b_ complexed with act, cgb |
PDB Entry: 2cbv (more details), 1.95 Å
SCOP Domain Sequences for d2cbvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbvb1 c.1.8.4 (B:3-444) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys tqkrivkdsgywysnvvknngl
Timeline for d2cbvb1: