![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.7: RNase Z-like [143916] (1 protein) part of Pfam PF00753; tRNA 3'-endonuclease; elaborated with additional structures and insert alpha(2)-beta(2) subdomain |
![]() | Protein Ribonuclease Z (RNase Z) [143917] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [143919] (1 PDB entry) Uniprot P0A8V0 1-305 |
![]() | Domain d2cbna1: 2cbn A:1-305 [130191] complexed with zn |
PDB Entry: 2cbn (more details), 2.9 Å
SCOPe Domain Sequences for d2cbna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} mnliflgtsagvptrtrnvtaillnlqhptqsglwlfdcgegtqhqllhtafnpgkldki fishlhgdhlfglpgllcsrsmsgiiqpltiygpqgirefvetalrisgswtdypleive igageilddglrkvtayplehplecygyrieehdapgalnaqalkaagvppgplfqelka gktitledgrqingadylaapvpgkalaifgdtgpcdaaldlakgvdvmvheatlditme akansrghsstrqaatlareagvgkliithvssryddkgcqhllrecrsifpatelandf tvfnv
Timeline for d2cbna1: