![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
![]() | Protein Hyaluronidase N-terminal domain [143619] (1 species) |
![]() | Species Clostridium perfringens [TaxId:1502] [143620] (3 PDB entries) Uniprot Q8XL08 41-178 |
![]() | Domain d2cbjb3: 2cbj B:41-178 [130190] Other proteins in same PDB: d2cbja1, d2cbja2, d2cbjb1, d2cbjb2 automatically matched to 2CBI A:41-178 complexed with cl, oan |
PDB Entry: 2cbj (more details), 2.35 Å
SCOP Domain Sequences for d2cbjb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbjb3 d.92.2.3 (B:41-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]} vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk qlvkesnipevnitdypt
Timeline for d2cbjb3: