SCOPe 2.02: Domain d2cbjb2: 2cbj B:179-495

Lineage for d2cbjb2 (2cbj B:179-495)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein Hyaluronidase catalytic domain [141792] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [141793] (3 PDB entries)
   Uniprot Q8XL08 179-495

8. Domain d2cbjb2: 2cbj B:179-495 [130189]
   Other proteins in same PDB: d2cbja1, d2cbja3, d2cbjb1, d2cbjb3
   automatically matched to 2CBI A:179-495
   complexed with cl, oan

Details for d2cbjb2

PDB Entry: 2cbj, 2.35 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase in complex with pugnac

PDB Compounds: (B:) hyaluronidase

SCOPe Domain Sequences for d2cbjb2:

Sequence; same for both SEQRES and ATOM records:

>d2cbjb2 c.1.8.10 (B:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

Timeline for d2cbjb2:

• d2cbjb2 first appeared in SCOP 1.73
  
• d2cbjb2 appears in SCOPe 2.01
  
• d2cbjb2 appears in SCOPe 2.03
  
• d2cbjb2 appears in the current release, SCOPe 2.08