Lineage for d2cbja1 (2cbj A:496-624)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780863Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 780864Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family) (S)
  5. 780865Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 780880Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)
  7. 780881Species Clostridium perfringens [TaxId:1502] [140660] (3 PDB entries)
    Uniprot Q8XL08 496-624
  8. 780886Domain d2cbja1: 2cbj A:496-624 [130185]
    Other proteins in same PDB: d2cbja2, d2cbja3, d2cbjb2, d2cbjb3
    automatically matched to 2CBI A:496-624
    complexed with cl, oan

Details for d2cbja1

PDB Entry: 2cbj (more details), 2.35 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase in complex with pugnac
PDB Compounds: (A:) hyaluronidase

SCOP Domain Sequences for d2cbja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbja1 a.246.1.1 (A:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

SCOP Domain Coordinates for d2cbja1:

Click to download the PDB-style file with coordinates for d2cbja1.
(The format of our PDB-style files is described here.)

Timeline for d2cbja1: