SCOPe 2.05: Domain d2cbia1: 2cbi A:496-624

Lineage for d2cbia1 (2cbi A:496-624)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries)
   Uniprot Q8XL08 496-624

8. Domain d2cbia1: 2cbi A:496-624 [130179]
   Other proteins in same PDB: d2cbia2, d2cbia3, d2cbib2, d2cbib3
   complexed with cl, gbl, gol, so4, zn

Details for d2cbia1

PDB Entry: 2cbi, 2.25 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase

PDB Compounds: (A:) hyaluronidase

SCOPe Domain Sequences for d2cbia1:

Sequence; same for both SEQRES and ATOM records:

>d2cbia1 a.246.1.1 (A:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

Timeline for d2cbia1:

• d2cbia1 first appeared in SCOP 1.73
  
• d2cbia1 appears in SCOPe 2.04
  
• d2cbia1 appears in SCOPe 2.06
  
• d2cbia1 appears in the current release, SCOPe 2.08