Lineage for d2cb3d_ (2cb3 D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429380Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1429381Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1429382Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1429443Protein automated matches [190549] (3 species)
    not a true protein
  7. 1429549Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187529] (1 PDB entry)
  8. 1429552Domain d2cb3d_: 2cb3 D: [130178]
    Other proteins in same PDB: d2cb3a1
    automated match to d2cb3a1
    complexed with gol, mld

Details for d2cb3d_

PDB Entry: 2cb3 (more details), 2.4 Å

PDB Description: crystal structure of peptidoglycan recognition protein-le in complex with tracheal cytotoxin (monomeric diaminopimelic acid-type peptidoglycan)
PDB Compounds: (D:) peptidoglycan-recognition protein-le

SCOPe Domain Sequences for d2cb3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cb3d_ d.118.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesr
gwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcr
nllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee

SCOPe Domain Coordinates for d2cb3d_:

Click to download the PDB-style file with coordinates for d2cb3d_.
(The format of our PDB-style files is described here.)

Timeline for d2cb3d_: