| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
| Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
| Protein automated matches [190549] (4 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187529] (1 PDB entry) |
| Domain d2cb3c_: 2cb3 C: [130177] Other proteins in same PDB: d2cb3a1 automated match to d2cb3a1 complexed with gol, mld |
PDB Entry: 2cb3 (more details), 2.4 Å
SCOPe Domain Sequences for d2cb3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cb3c_ d.118.1.1 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ghelsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhi
esrgwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadaln
mcrnllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee
Timeline for d2cb3c_: