SCOP 1.75: Domain d2cb3c1: 2cb3 C:174-344

Lineage for d2cb3c1 (2cb3 C:174-344)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (1 family)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (10 proteins)
   Family 2 zinc amidase;

6. Protein Peptidoglycan-recognition protein-LE [143788] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143789] (1 PDB entry)
   Uniprot Q9VXN9 174-344

8. Domain d2cb3c1: 2cb3 C:174-344 [130177]
   automatically matched to 2CB3 A:174-344
   complexed with gol, mld; mutant

Details for d2cb3c1

PDB Entry: 2cb3, 2.4 Å

PDB Description: crystal structure of peptidoglycan recognition protein-le in complex with tracheal cytotoxin (monomeric diaminopimelic acid-type peptidoglycan)

PDB Compounds: (C:) peptidoglycan-recognition protein-le

SCOP Domain Sequences for d2cb3c1:

Sequence; same for both SEQRES and ATOM records:

>d2cb3c1 d.118.1.1 (C:174-344) Peptidoglycan-recognition protein-LE {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesr
gwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcr
nllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee

Timeline for d2cb3c1:

• d2cb3c1 first appeared in SCOP 1.73
  
• d2cb3c1 is called d2cb3c_ in SCOPe 2.01
  
• d2cb3c1 appears in the current release, SCOPe 2.08, called d2cb3c_