![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
![]() | Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
![]() | Protein automated matches [190549] (4 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187529] (1 PDB entry) |
![]() | Domain d2cb3b_: 2cb3 B: [130176] Other proteins in same PDB: d2cb3a1 automated match to d2cb3a1 complexed with gol, mld |
PDB Entry: 2cb3 (more details), 2.4 Å
SCOPe Domain Sequences for d2cb3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cb3b_ d.118.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} saiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesrg wndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcrn llargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee
Timeline for d2cb3b_: