SCOPe 2.04: Domain d2cb3b_: 2cb3 B:

Lineage for d2cb3b_ (2cb3 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein automated matches [190549] (4 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187529] (1 PDB entry)

8. Domain d2cb3b_: 2cb3 B: [130176]
   Other proteins in same PDB: d2cb3a1
   automated match to d2cb3a1
   complexed with gol, mld

Details for d2cb3b_

PDB Entry: 2cb3, 2.4 Å

PDB Description: crystal structure of peptidoglycan recognition protein-le in complex with tracheal cytotoxin (monomeric diaminopimelic acid-type peptidoglycan)

PDB Compounds: (B:) peptidoglycan-recognition protein-le

SCOPe Domain Sequences for d2cb3b_:

Sequence; same for both SEQRES and ATOM records:

>d2cb3b_ d.118.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
saiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesrg
wndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcrn
llargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee

Timeline for d2cb3b_:

• d2cb3b_ first appeared in SCOP 1.73, called d2cb3b1
  
• d2cb3b_ appears in SCOPe 2.03
  
• d2cb3b_ appears in SCOPe 2.05
  
• d2cb3b_ appears in the current release, SCOPe 2.08