![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
![]() | Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
![]() | Protein Peptidoglycan-recognition protein-LE [143788] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143789] (1 PDB entry) Uniprot Q9VXN9 174-344 |
![]() | Domain d2cb3a1: 2cb3 A:174-344 [130175] Other proteins in same PDB: d2cb3b_, d2cb3c_, d2cb3d_ complexed with gol, mld |
PDB Entry: 2cb3 (more details), 2.4 Å
SCOPe Domain Sequences for d2cb3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cb3a1 d.118.1.1 (A:174-344) Peptidoglycan-recognition protein-LE {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} lsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesr gwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcr nllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee
Timeline for d2cb3a1: