Lineage for d2cb3a1 (2cb3 A:174-344)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536709Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2536710Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2536711Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2536760Protein Peptidoglycan-recognition protein-LE [143788] (1 species)
  7. 2536761Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143789] (1 PDB entry)
    Uniprot Q9VXN9 174-344
  8. 2536762Domain d2cb3a1: 2cb3 A:174-344 [130175]
    Other proteins in same PDB: d2cb3b_, d2cb3c_, d2cb3d_
    complexed with gol, mld

Details for d2cb3a1

PDB Entry: 2cb3 (more details), 2.4 Å

PDB Description: crystal structure of peptidoglycan recognition protein-le in complex with tracheal cytotoxin (monomeric diaminopimelic acid-type peptidoglycan)
PDB Compounds: (A:) peptidoglycan-recognition protein-le

SCOPe Domain Sequences for d2cb3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cb3a1 d.118.1.1 (A:174-344) Peptidoglycan-recognition protein-LE {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesr
gwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcr
nllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee

SCOPe Domain Coordinates for d2cb3a1:

Click to download the PDB-style file with coordinates for d2cb3a1.
(The format of our PDB-style files is described here.)

Timeline for d2cb3a1: