Lineage for d2cb2a1 (2cb2 A:2-308)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907117Family d.58.4.17: SOR-like [143278] (2 proteins)
    Pfam PF07682; duplication: consists of two similar domains
  6. 1907118Protein Sulfur oxygenase reductase SOR [143279] (1 species)
  7. 1907119Species Acidianus ambivalens [TaxId:2283] [143280] (1 PDB entry)
    Uniprot P29082 2-308
  8. 1907120Domain d2cb2a1: 2cb2 A:2-308 [130174]
    Other proteins in same PDB: d2cb2b_, d2cb2c_, d2cb2d_, d2cb2e_, d2cb2f_
    complexed with fe

Details for d2cb2a1

PDB Entry: 2cb2 (more details), 1.7 Å

PDB Description: sulfur oxygenase reductase from acidianus ambivalens
PDB Compounds: (A:) sulfur oxygenase reductase

SCOPe Domain Sequences for d2cb2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cb2a1 d.58.4.17 (A:2-308) Sulfur oxygenase reductase SOR {Acidianus ambivalens [TaxId: 2283]}
pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
wreylne

SCOPe Domain Coordinates for d2cb2a1:

Click to download the PDB-style file with coordinates for d2cb2a1.
(The format of our PDB-style files is described here.)

Timeline for d2cb2a1: