Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families) forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin |
Family a.2.17.2: VPS28 N-terminal domain [140115] (1 protein) includes structurally variable linker region |
Protein Vacuolar protein sorting-associated protein 28, VPS28 [140116] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140117] (3 PDB entries) Uniprot Q02767 15-125! Uniprot Q02767 23-123 |
Domain d2caze1: 2caz E:23-123 [130173] Other proteins in same PDB: d2caza1, d2cazc1, d2cazd1 automatically matched to 2CAZ B:23-123 |
PDB Entry: 2caz (more details), 3.6 Å
SCOP Domain Sequences for d2caze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2caze1 a.2.17.2 (E:23-123) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} plfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkllkqfkvyl nsqnkeeinkhfqsieafcdtynitasnaitrlergipita
Timeline for d2caze1:
View in 3D Domains from other chains: (mouse over for more information) d2caza1, d2cazb1, d2cazc1, d2cazd1 |