Lineage for d2cazd1 (2caz D:325-383)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2304155Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (4 families) (S)
    forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin
  5. 2304156Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein)
    automatically mapped to Pfam PF09454
  6. 2304157Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species)
  7. 2304158Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries)
    Uniprot P25604 322-385! Uniprot P25604 325-383
  8. 2304164Domain d2cazd1: 2caz D:325-383 [130172]
    Other proteins in same PDB: d2cazb1, d2cazc1, d2caze1
    automatically matched to 2CAZ A:325-383

Details for d2cazd1

PDB Entry: 2caz (more details), 3.6 Å

PDB Description: escrt-i core
PDB Compounds: (D:) suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease

SCOPe Domain Sequences for d2cazd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cazd1 a.2.17.1 (D:325-383) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnqlynlvaqdyaltdtieclsrmlhrgtipldtfvkqgrelarqqflvrwhiqritsp

SCOPe Domain Coordinates for d2cazd1:

Click to download the PDB-style file with coordinates for d2cazd1.
(The format of our PDB-style files is described here.)

Timeline for d2cazd1: