SCOPe 2.06: Domain d2cazd1: 2caz D:325-383

Lineage for d2cazd1 (2caz D:325-383)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families)
   forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin

5. Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein)
   automatically mapped to Pfam PF09454

6. Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries)
   Uniprot P25604 322-385! Uniprot P25604 325-383

8. Domain d2cazd1: 2caz D:325-383 [130172]
   Other proteins in same PDB: d2cazb1, d2cazc1, d2caze1
   automatically matched to 2CAZ A:325-383

Details for d2cazd1

PDB Entry: 2caz, 3.6 Å

PDB Description: escrt-i core

PDB Compounds: (D:) suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease

SCOPe Domain Sequences for d2cazd1:

Sequence; same for both SEQRES and ATOM records:

>d2cazd1 a.2.17.1 (D:325-383) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnqlynlvaqdyaltdtieclsrmlhrgtipldtfvkqgrelarqqflvrwhiqritsp

Timeline for d2cazd1:

• d2cazd1 first appeared in SCOP 1.73
  
• d2cazd1 appears in SCOPe 2.05
  
• d2cazd1 appears in SCOPe 2.07
  
• d2cazd1 appears in the current release, SCOPe 2.08