| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families) ![]() forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin |
| Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein) |
| Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries) |
| Domain d2cazd1: 2caz D:325-383 [130172] Other proteins in same PDB: d2cazb1, d2cazc1, d2caze1 automatically matched to 2CAZ A:325-383 |
PDB Entry: 2caz (more details), 3.6 Å
SCOP Domain Sequences for d2cazd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cazd1 a.2.17.1 (D:325-383) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnqlynlvaqdyaltdtieclsrmlhrgtipldtfvkqgrelarqqflvrwhiqritsp
Timeline for d2cazd1:
View in 3DDomains from other chains: (mouse over for more information) d2caza1, d2cazb1, d2cazc1, d2caze1 |