| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (4 families) ![]() forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin |
| Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein) automatically mapped to Pfam PF09454 |
| Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries) Uniprot P25604 322-385! Uniprot P25604 325-383 |
| Domain d2caza1: 2caz A:325-383 [130169] Other proteins in same PDB: d2cazb1, d2cazc1, d2caze1 |
PDB Entry: 2caz (more details), 3.6 Å
SCOPe Domain Sequences for d2caza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2caza1 a.2.17.1 (A:325-383) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnqlynlvaqdyaltdtieclsrmlhrgtipldtfvkqgrelarqqflvrwhiqritsp
Timeline for d2caza1:
View in 3DDomains from other chains: (mouse over for more information) d2cazb1, d2cazc1, d2cazd1, d2caze1 |