SCOPe 2.06: Domain d2cayb1: 2cay B:2-99,B:252-281

Lineage for d2cayb1 (2cay B:2-99,B:252-281)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein)
   PfamB PB030385

6. Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141445] (1 PDB entry)
   Uniprot Q06696 1-99,252-282

8. Domain d2cayb1: 2cay B:2-99,B:252-281 [130168]
   Other proteins in same PDB: d2caya2, d2cayb2
   automated match to d2caya1
   complexed with so4

Details for d2cayb1

PDB Entry: 2cay, 1.9 Å

PDB Description: vps36 n-terminal ph domain

PDB Compounds: (B:) vacuolar protein sorting protein 36

SCOPe Domain Sequences for d2cayb1:

Sequence; same for both SEQRES and ATOM records:

>d2cayb1 b.55.1.12 (B:2-99,B:252-281) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsqriiyiddak
ptqnslglelddlayvnyssgfltrsprlilffkdpssXstefvqlsfrksdgvlfsqat
eralenilt

Timeline for d2cayb1:

• d2cayb1 first appeared in SCOP 1.73
  
• d2cayb1 appears in SCOPe 2.05
  
• d2cayb1 appears in SCOPe 2.07
  
• d2cayb1 appears in the current release, SCOPe 2.08