Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein) PfamB PB030385 |
Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141445] (1 PDB entry) Uniprot Q06696 1-99,252-282 |
Domain d2cayb1: 2cay B:2-99,B:252-281 [130168] Other proteins in same PDB: d2caya2, d2cayb2 automated match to d2caya1 complexed with so4 |
PDB Entry: 2cay (more details), 1.9 Å
SCOPe Domain Sequences for d2cayb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cayb1 b.55.1.12 (B:2-99,B:252-281) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsqriiyiddak ptqnslglelddlayvnyssgfltrsprlilffkdpssXstefvqlsfrksdgvlfsqat eralenilt
Timeline for d2cayb1: