Lineage for d2cayb1 (2cay B:1-99,B:252-281)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673437Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein)
    PfamB 030385
  6. 673438Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species)
  7. 673439Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141445] (1 PDB entry)
  8. 673441Domain d2cayb1: 2cay B:1-99,B:252-281 [130168]
    automatically matched to 2CAY A:1-99,A:252-282
    complexed with so4

Details for d2cayb1

PDB Entry: 2cay (more details), 1.9 Å

PDB Description: vps36 n-terminal ph domain
PDB Compounds: (B:) vacuolar protein sorting protein 36

SCOP Domain Sequences for d2cayb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cayb1 b.55.1.12 (B:1-99,B:252-281) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
meywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsqriiyidda
kptqnslglelddlayvnyssgfltrsprlilffkdpssXstefvqlsfrksdgvlfsqa
teralenilt

SCOP Domain Coordinates for d2cayb1:

Click to download the PDB-style file with coordinates for d2cayb1.
(The format of our PDB-style files is described here.)

Timeline for d2cayb1: