Lineage for d2caxd_ (2cax D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089029Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1089030Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1089128Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins)
    plasmid-encoded, similar to the phage repressor family
  6. 1089133Protein automated matches [190225] (1 species)
    not a true protein
  7. 1089134Species Streptococcus pyogenes [TaxId:1314] [186986] (3 PDB entries)
  8. 1089146Domain d2caxd_: 2cax D: [130166]
    automated match to d1irqb_

Details for d2caxd_

PDB Entry: 2cax (more details), 2.9 Å

PDB Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct dna heptad repeats
PDB Compounds: (D:) orf omega

SCOPe Domain Sequences for d2caxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caxd_ a.43.1.4 (D:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

SCOPe Domain Coordinates for d2caxd_:

Click to download the PDB-style file with coordinates for d2caxd_.
(The format of our PDB-style files is described here.)

Timeline for d2caxd_: