SCOPe 2.07: Domain d2caxc2: 2cax C:20-71

Lineage for d2caxc2 (2cax C:20-71)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins)
   plasmid-encoded, similar to the phage repressor family
   automatically mapped to Pfam PF07764

6. Protein automated matches [190225] (1 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1314] [186986] (3 PDB entries)

8. Domain d2caxc2: 2cax C:20-71 [130165]
   Other proteins in same PDB: d2caxa3, d2caxc3
   automated match to d1irqb_

Details for d2caxc2

PDB Entry: 2cax, 2.9 Å

PDB Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct dna heptad repeats

PDB Compounds: (C:) orf omega

SCOPe Domain Sequences for d2caxc2:

Sequence; same for both SEQRES and ATOM records:

>d2caxc2 a.43.1.4 (C:20-71) automated matches {Streptococcus pyogenes [TaxId: 1314]}
akkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

Timeline for d2caxc2:

• d2caxc2 first appeared in SCOP 1.73, called d2caxc1
  
• d2caxc2 appears in SCOPe 2.06
  
• d2caxc2 appears in the current release, SCOPe 2.08