SCOP 1.75: Domain d2caxc1: 2cax C:23-71

Lineage for d2caxc1 (2cax C:23-71)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.4: Omega transcriptional repressor [100971] (1 protein)
   plasmid-encoded, similar to the phage repressor family

6. Protein Omega transcriptional repressor [69031] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [69032] (4 PDB entries)

8. Domain d2caxc1: 2cax C:23-71 [130165]
   automatically matched to d1irqb_

Details for d2caxc1

PDB Entry: 2cax, 2.9 Å

PDB Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct dna heptad repeats

PDB Compounds: (C:) orf omega

SCOP Domain Sequences for d2caxc1:

Sequence; same for both SEQRES and ATOM records:

>d2caxc1 a.43.1.4 (C:23-71) Omega transcriptional repressor {Streptococcus pyogenes [TaxId: 1314]}
dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

Timeline for d2caxc1:

• d2caxc1 first appeared in SCOP 1.73
  
• d2caxc1 is called d2caxc_ in SCOPe 2.01
  
• d2caxc1 appears in the current release, SCOPe 2.08, called d2caxc2