![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.4: Omega transcriptional repressor [100971] (1 protein) plasmid-encoded, similar to the phage repressor family |
![]() | Protein Omega transcriptional repressor [69031] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [69032] (4 PDB entries) |
![]() | Domain d2caxc1: 2cax C:23-71 [130165] automatically matched to d1irqb_ |
PDB Entry: 2cax (more details), 2.9 Å
SCOP Domain Sequences for d2caxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2caxc1 a.43.1.4 (C:23-71) Omega transcriptional repressor {Streptococcus pyogenes [TaxId: 1314]} dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
Timeline for d2caxc1: