Lineage for d2caxc1 (2cax C:23-71)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769512Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 769513Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 769611Family a.43.1.4: Omega transcriptional repressor [100971] (1 protein)
    plasmid-encoded, similar to the phage repressor family
  6. 769612Protein Omega transcriptional repressor [69031] (1 species)
  7. 769613Species Streptococcus pyogenes [TaxId:1314] [69032] (4 PDB entries)
  8. 769626Domain d2caxc1: 2cax C:23-71 [130165]
    automatically matched to d1irqb_

Details for d2caxc1

PDB Entry: 2cax (more details), 2.9 Å

PDB Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct dna heptad repeats
PDB Compounds: (C:) orf omega

SCOP Domain Sequences for d2caxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caxc1 a.43.1.4 (C:23-71) Omega transcriptional repressor {Streptococcus pyogenes [TaxId: 1314]}
dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

SCOP Domain Coordinates for d2caxc1:

Click to download the PDB-style file with coordinates for d2caxc1.
(The format of our PDB-style files is described here.)

Timeline for d2caxc1: