SCOPe 2.02: Domain d2caxb_: 2cax B:

Lineage for d2caxb_ (2cax B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins)
   plasmid-encoded, similar to the phage repressor family

6. Protein automated matches [190225] (1 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1314] [186986] (3 PDB entries)

8. Domain d2caxb_: 2cax B: [130164]
   automated match to d1irqb_

Details for d2caxb_

PDB Entry: 2cax, 2.9 Å

PDB Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct dna heptad repeats

PDB Compounds: (B:) orf omega

SCOPe Domain Sequences for d2caxb_:

Sequence; same for both SEQRES and ATOM records:

>d2caxb_ a.43.1.4 (B:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

Timeline for d2caxb_:

• d2caxb_ first appeared in SCOP 1.73, called d2caxb1
  
• d2caxb_ appears in SCOPe 2.01
  
• d2caxb_ appears in SCOPe 2.03
  
• d2caxb_ appears in the current release, SCOPe 2.08