Lineage for d2caqa2 (2caq A:4-84)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134060Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225080] (4 PDB entries)
  8. 2134061Domain d2caqa2: 2caq A:4-84 [130160]
    Other proteins in same PDB: d2caqa1
    automated match to d2f8fa2
    complexed with bme, gsh, pg4; mutant

Details for d2caqa2

PDB Entry: 2caq (more details), 2 Å

PDB Description: structure of r21l mutant of sh28gst in complex with gsh
PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2caqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caqa2 c.47.1.0 (A:4-84) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

SCOPe Domain Coordinates for d2caqa2:

Click to download the PDB-style file with coordinates for d2caqa2.
(The format of our PDB-style files is described here.)

Timeline for d2caqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2caqa1