SCOPe 2.03: Domain d2caqa2: 2caq A:4-84

Lineage for d2caqa2 (2caq A:4-84)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225080] (3 PDB entries)

8. Domain d2caqa2: 2caq A:4-84 [130160]
   Other proteins in same PDB: d2caqa1
   automated match to d2f8fa2
   complexed with bme, gsh, pg4; mutant

Details for d2caqa2

PDB Entry: 2caq, 2 Å

PDB Description: structure of r21l mutant of sh28gst in complex with gsh

PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2caqa2:

Sequence; same for both SEQRES and ATOM records:

>d2caqa2 c.47.1.0 (A:4-84) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

Timeline for d2caqa2:

• d2caqa2 first appeared in SCOP 1.73
  
• d2caqa2 appears in SCOPe 2.02
  
• d2caqa2 appears in SCOPe 2.04
  
• d2caqa2 appears in the current release, SCOPe 2.08