Lineage for d2caqa1 (2caq A:85-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713550Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225081] (4 PDB entries)
  8. 2713557Domain d2caqa1: 2caq A:85-207 [130159]
    Other proteins in same PDB: d2caqa2
    automated match to d2f8fa1
    complexed with bme, gsh, pg4; mutant

Details for d2caqa1

PDB Entry: 2caq (more details), 2 Å

PDB Description: structure of r21l mutant of sh28gst in complex with gsh
PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2caqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caqa1 a.45.1.1 (A:85-207) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
dra

SCOPe Domain Coordinates for d2caqa1:

Click to download the PDB-style file with coordinates for d2caqa1.
(The format of our PDB-style files is described here.)

Timeline for d2caqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2caqa2