Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (8 PDB entries) |
Domain d2caib1: 2cai B:85-207 [130157] Other proteins in same PDB: d2caia2, d2caib2 automatically matched to d1oe7a1 complexed with bme, pg4, so4; mutant |
PDB Entry: 2cai (more details), 2.26 Å
SCOP Domain Sequences for d2caib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2caib1 a.45.1.1 (B:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls dra
Timeline for d2caib1: